PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen07g003170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family TALE
Protein Properties Length: 419aa    MW: 46538.2 Da    PI: 6.2357
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen07g003170.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.59.7e-083623952154
                       HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       k +yp++e++++L +++gL+ +q+ +WF N+R +
  Sopen07g003170.1 362 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 395
                       469*****************************87 PP

2ELK28.82.7e-10316337122
               ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                       ELKh+L+++Y+++++++++E++
  Sopen07g003170.1 316 ELKHELKQGYKEKIVDIREEIL 337
                       9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.1E-19150194IPR005540KNOX1
PfamPF037903.8E-17152193IPR005540KNOX1
SMARTSM012566.4E-25203259IPR005541KNOX2
PfamPF037911.2E-18209258IPR005541KNOX2
PROSITE profilePS512139.969316336IPR005539ELK domain
SMARTSM011886.1E-4316337IPR005539ELK domain
PfamPF037899.7E-7316337IPR005539ELK domain
PROSITE profilePS5007111.726336399IPR001356Homeobox domain
SuperFamilySSF466894.71E-16338402IPR009057Homeodomain-like
SMARTSM003894.7E-11338403IPR001356Homeobox domain
CDDcd000862.88E-11339400No hitNo description
Gene3DG3DSA:1.10.10.603.0E-25343400IPR009057Homeodomain-like
PfamPF059201.2E-17356395IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
MVLHQQQQQQ QQQQQQNAVL RSMLPESPHH DARKSPPTWL NTSLLRQQHS QFGNASSPSS  60
AAAAAAVAGG NNFLHLQTSN SDSSNSNQWL SPTAAAGGGG NAGGGGHNDE LSESMNFAKK  120
MSQQHSGGGE ENNNNNNNNN NEEENSWERE KCKADILNHP LYDQLLSAHV SCLRIATPVD  180
QLPRIDAQLA QSQNVVAKYS VLGQGQPPLD DKDLDQFMTH YVLLLSSFKE QLQQHVRVHA  240
MEAVMACWEL EQSLQSLTGV APGEGTGATM SDDDDDQADS DTNFLDGGFD GPDSMGFGPL  300
VPTESERSLM ERVRQELKHE LKQGYKEKIV DIREEILRKR RAGKLPGDTT SVLKAWWQSH  360
SKWPYPTEED KARLVQETGL QLKQINNWFI NQRKRNWHSN PSTSSSQKSK RKSAGETKQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A2e-12339403872Homeobox protein PKNOX1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ2612470.0GQ261247.1 Solanum lycopersicum cultivar Rio Grande PtoR Hop-interacting protein THI041 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015082177.10.0PREDICTED: homeobox protein knotted-1-like LET12
SwissprotO223000.0LET12_SOLLC; Homeobox protein knotted-1-like LET12
TrEMBLG8Z2690.0G8Z269_SOLLC; Hop-interacting protein THI041
STRINGSolyc07g007120.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14322472
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.11e-154KNOTTED1-like homeobox gene 3